The short version of freeze-thaw fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-12-24. Anything still debated is marked as such rather than presented as settled.
Lyophilization removes water from a peptide solution under vacuum, leaving a porous cake or a loose powder. The dry form often improves stability during shipping and storage because water-mediated degradation slows. Reconstitution reverses the process by adding a solvent so peptide molecules hydrate and enter solution. Complete dissolution depends on peptide sequence, purity, salt form, and any excipients present. Some lyophilized powders dissolve quickly, while others form haze, gels, or persistent particles.
Solvent selection affects pH, ionic strength, and preservative content in the final liquid. Sterile water and bacteriostatic water containing benzyl alcohol are common in laboratory settings. Buffer systems may be used when a peptide is sensitive to pH shifts during dissolution. Acidic or basic conditions can change the net charge of ionizable groups and therefore solubility. Organic cosolvents are sometimes added for hydrophobic sequences, though they can also promote unfolding or aggregation.
During reconstitution, solvent penetrates the powder, breaks interparticle contacts, and solvates polar and nonpolar groups. Gentle mixing or swirling can speed dissolution, while vigorous shaking may introduce foaming and surface denaturation. Aggregation becomes more likely when the peptide concentration exceeds its solubility or when the pH is near the isoelectric point. The link between a specific reconstitution method and long-term stability is not fully predictable from sequence alone. How excipients, container surfaces, and residual moisture influence aggregation remains an open question.
After reconstitution, the peptide solution is less stable than the dried powder because water enables hydrolysis, oxidation, and microbial growth. Storage temperature, pH, buffer composition, and container material all affect how long the solution remains usable. Many peptides are kept at 2–8 °C for short-term work, while frozen aliquots at −20 °C or below are used for longer intervals. Repeated freeze-thaw cycles can cause aggregation or precipitation. The choice of storage condition should be based on stability data for the specific peptide.
Quality checks after reconstitution include visual inspection, pH measurement, and analytical methods such as reversed-phase high-performance liquid chromatography. These tests can detect insoluble material, degradation products, and changes in concentration. Mass spectrometry is often used to confirm molecular identity when the peptide sequence is known. Because a clear solution can still contain aggregates or modified peptide, visual clarity alone is not sufficient. Analytical results are compared with a reference standard or the pre-reconstitution certificate of analysis.
| Property | Value | Notes |
|---|---|---|
| Physical form before reconstitution | Lyophilized powder or cake | Appearance depends on formulation and drying cycle |
| Common solvent class | Aqueous, often sterile or bacteriostatic | Buffer or cosolvent may be required for some sequences |
| Key solution variable | pH | Charge state and solubility can change sharply near the isoelectric point |
| Typical solubility range | Micrograms to milligrams per milliliter | Wide variation across peptide sequences and salt forms |
| Primary visual check | Clarity and absence of particles | Haze or gel formation may indicate incomplete dissolution or aggregation |
The choice of solvent depends on the peptide's sequence, charge, and solubility profile. Water is common for hydrophilic peptides, while aqueous mixtures containing acetonitrile, methanol, or a small amount of acid may be needed for hydrophobic or basic sequences. Adding the liquid to the powder, rather than the reverse, can reduce clumping and improve wetting. Gentle mixing or brief vortexing may help, but vigorous agitation can create foam and shear sensitive structures. Complete dissolution is judged by a clear solution with no visible particles.
Buffer components and ionic strength affect how a peptide dissolves and remains in solution. Some sequences require a defined pH range to avoid precipitation or aggregation, while others tolerate pure water. The optimal conditions are often determined empirically because solubility cannot be predicted reliably from sequence alone. Even when a peptide dissolves, the resulting solution may contain aggregates that are not visible to the eye. Analytical methods such as reversed-phase high-performance liquid chromatography and mass spectrometry are used to confirm identity and purity after reconstitution.
Once a peptide is in liquid form, its stability depends on temperature, pH, concentration, and the presence of oxygen or microbes. Refrigeration slows many degradation pathways, while freezing can extend storage for longer periods. Repeated freeze-thaw cycles are generally avoided because ice crystal formation and concentration changes can promote aggregation. Light exposure can also damage peptides that contain aromatic or sulfur-containing residues. A common laboratory practice is to divide a reconstituted stock into single-use aliquots before freezing, but the optimal storage condition remains peptide-specific and is often determined empirically.
Analytical checks help determine whether a reconstituted peptide matches its expected identity and purity; reverse-phase high-performance liquid chromatography separates components by hydrophobicity and can reveal degradation products or impurities. Mass spectrometry provides a mass measurement that supports sequence identity when compared with the theoretical value. Ultraviolet absorbance at 280 nm can estimate concentration for peptides containing tryptophan or tyrosine, though sequence-dependent extinction coefficients are needed. For shorter or non-aromatic peptides, other methods such as amino acid analysis may be required. These techniques describe the material rather than guarantee its biological effect.
Cloudiness, particles, or gel formation after reconstitution can signal incomplete dissolution, aggregation, or contamination. A clear solution is not proof of purity, and a cloudy one is not always unusable if the peptide is designed to form suspensions. pH measurement can identify whether the solution matches the intended range, and buffer exchange may be needed when the original solvent is incompatible. Sterile filtration is sometimes used for microbial control, but filters can adsorb peptides and reduce concentration. Documentation of lot number, solvent, volume, date, and storage condition supports later traceability in laboratory records.
Aseptic technique matters because aqueous peptide solutions can support microbial growth. Sterile solvents, clean workspaces, and sterile filtration can reduce contamination. The choice of filter material and pore size must avoid peptide loss through adsorption, especially for hydrophobic or low-concentration samples. Visual inspection for particles, turbidity, or color change provides a simple initial check, but it cannot confirm identity or purity. Analytical methods such as reversed-phase high-performance liquid chromatography and mass spectrometry are used to verify composition and detect degradation products.
Documentation supports reproducibility and traceability. Records often include lot number, solvent composition, final concentration, preparation date, and storage location. Such details help distinguish procedural variation from actual sample instability. Questions remain about how best to predict long-term stability from short-term accelerated studies, because peptide degradation pathways differ widely. For many peptides, the relationship between in vitro solution stability and biological behavior is incompletely understood and is an active area of research.
After reconstitution, a peptide solution is typically stored under conditions that limit degradation. Cool temperatures slow hydrolysis and oxidation, while freezing can preserve samples for longer periods. Repeated freeze-thaw cycles may promote aggregation or precipitation, so aliquoting before freezing is a common laboratory practice. The optimal storage temperature depends on the peptide sequence, buffer composition, and expected duration. Solutions containing oxidizable residues may benefit from inert gas overlays or antioxidants, though compatibility with the specific peptide must be considered.
In 2020, PTC acquired Censa Pharmaceuticals, Inc., a biopharmaceutical company focused on the development of CNSA-001 (sepiapterin), a clinical-stage investigational therapy for orphan metabolic diseases, including phenylketonuria (PKU) and other diseases associated with defects in the tetrahydrobiopterin (BH4) biochemical pathways diagnosed at birth. In 2020, PTC announced the FDA approval of Evrysdi (risdiplam) for the treatment of spinal muscular atrophy (SMA) in adults and children 2 months and older. In 2024, Novartis has committed $1 billion upfront in a licensing deal with PTC Therapeutics for an experimental treatment for Huntington’s disease, with the potential for an additional $1.9 billion tied to achieving specific development, regulatory, and commercial milestones. PTC Therapeutics’ therapy, known as PTC518, is an oral medication designed to reduce the production of the mutant protein linked to the genetic mutation responsible for the disease. This mutant protein is believed to contribute to neuronal death, driving disease progression. In June, interim data from a Phase 2 trial indicated that PTC518 successfully lowered levels of the mutant protein in both blood and cerebrospinal fluid.
Phage display libraries of 109 randomized sequences are used to screen for Affimer proteins that exhibit high-specificity binding to the target protein with binding affinities in the nM range. The ability to direct in vitro screening techniques allows the identification of specific, high affinity Affimers. In vitro screening and development also mean that the target space for Affimers is not limited by the animal immune system. Affimers are generated using recombinant systems, so their generation is more rapid and reproducible compared to the production of polyclonal antibodies. Multimeric forms Affimers have been generated and shown to yield titres in the range of 200–400 mg/L under small-scale culture using bacterial host systems. Multimeric forms of Affimers with the same target specificity provide avidity effects in target binding. Many different tags and fusion proteins, such as fluorophores, single-stranded DNA, His, and c-Myc tags can be conjugated to Affimers. Specific cysteine residues can be introduced to the protein to allow thiol chemistry to uniformly orient Affimers on a solid support eg ELISA plates. This flexible functionalisation of the Affimer molecule allows functionality across multiple applications and assay formats.
Some proteins that are disordered or helical as monomers, such as amyloid β (see amyloid plaque) can form β-sheet-rich oligomeric structures associated with pathological states. The amyloid β protein's oligomeric form is implicated as a cause of Alzheimer's. Its structure has yet to be determined in full, but recent data suggest that it may resemble an unusual two-strand β-helix. The side chains from the amino acid residues found in a β-sheet structure may also be arranged such that many of the adjacent sidechains on one side of the sheet are hydrophobic, while many of those adjacent to each other on the alternate side of the sheet are polar or charged (hydrophilic), which can be useful if the sheet is to form a boundary between polar/watery and nonpolar/greasy environments. Collagen helix Foldamers Folding (chemistry) Tertiary structure α-helix Structural motif Anatomy & Taxonomy of Protein Structures -survey Archived 2019-03-16 at the Wayback Machine NetSurfP - Secondary Structure and Surface Accessibility predictor
Sources: en.wikipedia.org
C4H2N2O4 + GSH → C4H3N2O4• + GS• C4H3N2O4• + GSH → C4H4N2O4 + GS• C4H4N2O4 + O2 → C4H3N2O4• + O2•− + H+ C4H3N2O4• + O2 → C4H2N2O4 + O2•− + H+ Because it selectively kills the insulin-producing beta-cells found in the pancreas, alloxan is used to induce diabetes in laboratory animals. This occurs most likely because of selective uptake of the compound due to its structural similarity to glucose as well as the beta-cell's highly efficient uptake mechanism (GLUT2). In addition, alloxan has a high affinity to SH-containing cellular compounds and, as a result, reduces glutathione content. Furthermore, alloxan inhibits glucokinase, a SH-containing protein essential for insulin secretion induced by glucose. Most studies have shown that alloxan is not toxic to the human beta-cell, even in very high doses, probably because of differing glucose uptake mechanisms in humans and rodents. Alloxan is, however, toxic to the liver and the kidneys in high doses, as these are tissues where the GLUT2 transporter is expressed in humans. Streptozotocin
A 15-hydroxyicosatetraenoate dehydrogenase metabolizes 15-hydroxyicosatetraenoic acid (i.e. 15(S)-hydroxy-5Z,8Z,11Z,13E-eicosatetraenoic acid or 15-HETE) to its 15-keto analog, 15-oxo-ETE, using NAD+ and NADH rather than NADP+ and NADPH as its co-factors. 15-Oxo-ETE appears to have a somewhat different spectrum of activities than its precursor, 15-HETE (see 15-Hydroxyicosatetraenoic acid
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
A skeletal survey is useful to confirm the diagnosis of achondroplasia. The skull is large, with a narrow foramen magnum, and relatively small skull base. The vertebral bodies are short and flattened with relatively large intervertebral disk height, and there is congenitally narrowed spinal canal. The iliac wings are small and squared, with a narrow sciatic notch and horizontal acetabular roof. The tubular bones are short and thick with metaphyseal cupping and flaring and irregular growth plates. Fibular overgrowth is present. The hand is broad with short metacarpals and phalanges, and a trident configuration. The ribs are short with cupped anterior ends. If the radiographic features are not classic, a search for a different diagnosis should be entertained. Because of the extremely deformed bone structure, people with achondroplasia are often "double jointed". The diagnosis can be made by fetal ultrasound by progressive discordance between the short femur length and biparietal diameter by age. The trident hand configuration can be seen if the fingers are fully extended. Another common characteristic of the syndrome is thoracolumbar gibbus in infancy.
Sources: en.wikipedia.org
TMEM125 has two variant transcripts that differ only in the 5' untranslated region (UTR), but both encode the same protein. mRNA variant 1 represents the longer of the two variants and is 1898 base pairs (bp) in length; variant 2 is 1797 bp long. TMEM125 microarray-assessed expression patterns in normal human tissue demonstrate the primary tissues of expression are the pancreas, lungs, salivary glands, trachea, brain, prostate, spinal cord, and thyroid. Additionally, RNA-seq data illustrates transcript expression in the following additional tissue: colon, small intestines, prostate, and stomach. TMEM125 comprises 219 amino acids with four transmembrane domains. Its predicted isoelectric point is 8.32 and predicted molecular weight is 22.1 kDa. It is primarily leucine-rich, and secondarily alanine- and glycine-rich; TMEM125 is also arginine- and lysine-deficient. It has two core repeat blocks, VALL and TTSS, which both appear twice within the protein. The secondary structure of TMEM125 is predicted to consist of α-helices and small segments of β-sheets.
A clinical data management system (CDMS) is a tool used in clinical research to manage the data of a clinical trial. The clinical trial data gathered at the investigator site in the case report form are stored in the CDMS. To reduce the possibility of errors due to human entry, the systems employ various means to verify the data. Systems for clinical data management can be self-contained or part of the functionality of a CTMS. A CTMS with clinical data management functionality can help with the validation of clinical data as well as helps the site employ for other important activities like building patient registries and assist in patient recruitment efforts. The CDMS can be broadly divided into paper-based and electronic data capture systems.
Evolutionary developmental biology compares the developmental processes of different organisms to infer how developmental processes evolved. The field grew from 19th-century beginnings, where embryology faced a mystery: zoologists did not know how embryonic development was controlled at the molecular level. Charles Darwin noted that having similar embryos implied common ancestry, but little progress was made until the 1970s. Then, recombinant DNA technology at last brought embryology together with molecular genetics. A key early discovery was that of homeotic genes that regulate development in a wide range of eukaryotes. The field explores deep homology, the finding that dissimilar organs such as the eyes of insects, vertebrates and cephalopod molluscs, long thought to have evolved separately, are controlled by similar genes from the evo-devo gene toolkit.
Sources: en.wikipedia.org
It is the process of adding a liquid solvent to a dried peptide powder so that the peptide dissolves and forms a solution. The dried form is usually produced by lyophilization, and the solvent is chosen based on the peptide and the intended laboratory use.
Incomplete dissolution can result from low solubility, an unsuitable pH, or aggregation. It may also reflect residual salts, fillers, or manufacturing impurities that do not dissolve under the chosen conditions.
Yes. Solvent pH, ionic strength, preservatives, and cosolvents can all influence degradation or aggregation. A solvent that gives a clear solution does not automatically provide the best long-term stability.
Short-term storage is often at 2 to 8 °C, while longer storage may use frozen aliquots at −20 °C or below. Repeated freeze-thaw cycles should be avoided because they can promote aggregation.